PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 897aa    MW: 99986.2 Da    PI: 6.7416
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00105genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.53.1e-102522955499
                EETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
         B3  54 kksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                ++++r++l++GW+ Fv++++L +gD ++F   + +++el+v+v+r+
  AA5G00105 252 GQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 295
                57899*************************..449999*****996 PP

2Auxin_resp120.11.8e-39320402183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++++GmRfkm+fe+e+++e+r++Gt+vg++d+dp+rW +SkWrsLk
   AA5G00105 320 AWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPTRWAKSKWRSLK 402
                 89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.9E-37159220IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.44E-23160222IPR015300DNA-binding pseudobarrel domain
CDDcd100174.33E-15161294No hitNo description
PROSITE profilePS508639.305163296IPR003340B3 DNA binding domain
SMARTSM010191.9E-8163296IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-37252309IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.09E-10252323IPR015300DNA-binding pseudobarrel domain
PfamPF023622.0E-7252295IPR003340B3 DNA binding domain
PfamPF065071.3E-36320402IPR010525Auxin response factor
PfamPF023096.0E-5753807IPR033389AUX/IAA domain
SuperFamilySSF542771.13E-11769848No hitNo description
PROSITE profilePS5174525.747771855IPR000270PB1 domain
PfamPF023098.2E-7817855IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MVSSEISMKR DRGGENFSSG YSDAKEARNV SISGEGQKSH YSRSITAERT VDPETALYRE  60
LWHACAGPLV TVPRKDDRVF YFPQGHIEQV EASTNQEAEQ QMPLYDLPSK LLCRVINVDL  120
KAEADTDEVY AQITLLPEAN QDENAIEKEA PPPPPPRFQV HSFCKTLTAS DTSTHGGFSV  180
LRRHADECLP PLDMSRQPPT QELVAKDLHS NEWRFRHIFR GTYECPHMVS FGAVSVPCFL  240
SAIDVCVNVI PGQPRRHLLQ SGWSVFVSSK RLVAGDAFIF LRGENGELRV GVRRAMRQQG  300
NVPSSVISSH SMHLGVLATA WHAISTGTMF TVYYKPRTSP SEFIVPFDQY MESVKNNYTI  360
GMRFKMRFEG EEAPEQRFTG TIVGIEDSDP TRWAKSKWRS LKVRWDETSS IPRPERVSPW  420
KIEPALAPPA LSPVPMPRPK RPRPNIAPSS PDSSVLAREG NVFPFIAVHV LVRREGSSKA  480
NMDPLPASGL SRVLQGQEYS TLRTKLTESV ESDVPESSVV WQSSADDDKV DVVSVSRRYG  540
AENWMSSGRH EPTYTDLLSG FGANVDPSHG QRLPFYDHSL SPSVPTKKIS NDQDGKFDYI  600
SNQWQMMHSG LSLKLSESPK VPVAASNVKY GEYPVLHSLT TENSSGNWPI RPRALNYFED  660
MAHVQAQAQA QSQAQAREHA TKRPVMMLQE ETGKTRDGNC RIFGIPLVTG TDSTMPQRNN  720
VNESAGLTQI ASPKVQDLSE QSKASKSGNE PREQSKQFQT KEAQGKTNSN RSCTKVHKQG  780
SALGRSVDLS KFNNYEELIR ELDTLFEFNG ELMAPKKDWL IVYTDDEGDM MLVGDDPWQE  840
FCCMVRKIVI YTKEEVRKIK PGSLSCRSDE DAVVGEGSDT KDAKSASNPS LSSAGNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B1e-1745642418354Auxin response factor 1
4ldx_A1e-1745642418354Auxin response factor 1
4ldw_B1e-1745642418354Auxin response factor 1
4ldw_A1e-1745642418354Auxin response factor 1
4ldv_A1e-1745642418354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1439443KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201006.20.0auxin response factor 2
RefseqNP_851244.10.0auxin response factor 2
RefseqNP_974980.10.0auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLV4K1E70.0V4K1E7_EUTSA; Auxin response factor
STRINGAT5G62000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2